PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr1P23300_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 432aa    MW: 47674.6 Da    PI: 6.3756
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr1P23300_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.18.2e-102402771954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yp+ +e+  LA+++gLt +qV++WF N R +
  GSMUA_Achr1P23300_001 240 FEHflHPYPNDSEKLMLARQTGLTRSQVSNWFINARVR 277
                            664559******************************88 PP

2BELL117.85.2e-38103174172
                   BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            erq+lq+k +kLl++l+e+d+rYkqy++q+q+v+ssF++vag g+akpYt+l l++iS hFrcL+dai+  i
  GSMUA_Achr1P23300_001 103 ERQDLQNKVTKLLTMLDEIDRRYKQYYHQMQIVVSSFDVVAGFGAAKPYTALSLQTISGHFRCLRDAISREI 174
                            799*****************************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.8E-5827172IPR006563POX domain
PfamPF075263.8E-5033171IPR006563POX domain
PROSITE profilePS5007112.584218281IPR001356Homeobox domain
SMARTSM003898.4E-11221285IPR001356Homeobox domain
CDDcd000865.78E-14221282No hitNo description
SuperFamilySSF466894.71E-18222288IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.8E-29224287IPR009057Homeodomain-like
PfamPF059201.1E-17238277IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MPNIFLPFIA AYYLIYENNE LLLEVISSLA SSIINSKYLK AAQELLDEVV NVQKALKRKS  60
IKSQSLHTSA GTTTGKDCSA GEGMSSNPQD STINSSSELS PSERQDLQNK VTKLLTMLDE  120
IDRRYKQYYH QMQIVVSSFD VVAGFGAAKP YTALSLQTIS GHFRCLRDAI SREILVTRKS  180
LGEEGNSGSK GVGMSRLRYI DQQLRQQRAL QQFGMMQQHA WRPQRGLPES SVSILRAWLF  240
EHFLHPYPND SEKLMLARQT GLTRSQVSNW FINARVRLWK PMIEDMYKEE TGDLEIDSSL  300
ENPPKDQDGV HSTGNGENSH NTATERCQVN QLKECSYVQD ALAHIDGTGR FMAYADLGCG  360
GGGGVSLTLG LQHCDGGLPG SGSQQSFVGM QGGDIYSAAA AIGADTAEYD CVNLGDRPHR  420
FASSQLLHDF VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B4e-18227284158Homeobox protein Meis1
4xrs_A4e-18227284158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009407184.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_009407176.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_009407168.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_009407161.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_009407152.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9SIW11e-140BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLM0S2D70.0M0S2D7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr1P23300_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16400.11e-121BEL1-like homeodomain 7